AibGenesis™ Mouse Anti-sh2d5 Antibody (CBMOAB-97996FYA)


Cat: CBMOAB-97996FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97996FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO97996FYA 100 µg
MO-AB-05959W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05959W 100 µg
MO-AB-22155W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22155W 100 µg
MO-AB-28959H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28959C 100 µg
MO-AB-64297W Monoclonal Marmoset WB, ELISA MO64297W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO97996FYA
SpecificityThis antibody binds to Zebrafish sh2d5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish sh2d5 Antibody is a mouse antibody against sh2d5. It can be used for sh2d5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessh2d5; SH2 Domain Containing 5
UniProt IDF1Q5B0
Protein RefseqThe length of the protein is 410 amino acids long.
The sequence is show below: MFKRQTPQPGSVWNMGETAGREHGTVTRSAEYIGSFPVDDSCLDDQIQQLHTQLKSLKNCKSKRTVSLRFSVKGVKVYDEDETTLLMAHAMCRVSLSTARPSDAQFAFASHNPGNSDAQLYCHLFRARHARAAQFLNLLLCRCFQLYFLEKHPEEAQEECSGKKPSRAPSLLNQGFPLSVSALVSFRRAPTQGLLPGAKLFSQQSTEQVSSPEEGPTSSPTIVRKMAIRTKELRSGAYRSFTFTPLKQRHLQDKLSAPQEKEQATAKACMSRAPSLAETEEALAQAVWCWAGVSSDCSSSLLADDVLGAFLLCPHPKKPNRGSLIVRFSSGLVTYAIKNSKGKFRLEKCHTDFESLAALMEHYTEFGDELECSLSCARVNHCYDWEEMVNKGSRLLQDNKKGTFKCRSWV.
For Research Use Only | Not For Clinical Use.
Online Inquiry