AibGenesis™ Mouse Anti-sh3bgrl2 Antibody (CBMOAB-98001FYA)


Cat: CBMOAB-98001FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-98001FYA Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO98001FYA 100 µg
MO-AB-01355L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01355L 100 µg
MO-AB-09295W Monoclonal Cat (Felis catus) WB, ELISA MO09295W 100 µg
MO-AB-09904Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09904Y 100 µg
MO-AB-20083R Monoclonal Cattle (Bos taurus) WB, ELISA MO20083R 100 µg
MO-AB-28963H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28963C 100 µg
MO-AB-35662W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35662W 100 µg
MO-AB-64301W Monoclonal Marmoset WB, ELISA MO64301W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO98001FYA
SpecificityThis antibody binds to Zebrafish sh3bgrl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish sh3bgrl2 Antibody is a mouse antibody against sh3bgrl2. It can be used for sh3bgrl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSH3 domain-binding glutamic acid-rich-like protein 2; sh3bgrl
UniProt IDQ6GMK7
Protein RefseqThe length of the protein is 105 amino acids long.
The sequence is show below: MVIRVYIASSSGSVAVKKRQQAIVGFLEANRISFEEVDITMLEDQRLWMYQKIPDEKRPEKGNPLPPQIFNGEDYCGDYEDFFQSKETNTVFSFLRLPSVKDSES.
For Research Use Only | Not For Clinical Use.
Online Inquiry