AibGenesis™ Mouse Anti-shfm1 Antibody (CBMOAB-98103FYA)
Cat: CBMOAB-98103FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-98103FYA | Monoclonal | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset | WB, ELISA | MO98103FYA | 100 µg | ||
| MO-AB-23526W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23526W | 100 µg | ||
| MO-AB-64345W | Monoclonal | Marmoset | WB, ELISA | MO64345W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset |
| Clone | MO98103FYA |
| Specificity | This antibody binds to Zebrafish shfm1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish shfm1 Antibody is a mouse antibody against shfm1. It can be used for shfm1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Shfm1 protein; Split hand/foot malformation (Ectrodactyly) type 1; shfm |
| UniProt ID | Q7ZU84 |
| Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: MSEKKQTVDLGLLEEDDEFEEFPAEDWTGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry