AibGenesis™ Mouse Anti-shfm1 Antibody (CBMOAB-98103FYA)


Cat: CBMOAB-98103FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-98103FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO98103FYA 100 µg
MO-AB-23526W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23526W 100 µg
MO-AB-64345W Monoclonal Marmoset WB, ELISA MO64345W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO98103FYA
SpecificityThis antibody binds to Zebrafish shfm1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish shfm1 Antibody is a mouse antibody against shfm1. It can be used for shfm1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesShfm1 protein; Split hand/foot malformation (Ectrodactyly) type 1; shfm
UniProt IDQ7ZU84
Protein RefseqThe length of the protein is 70 amino acids long.
The sequence is show below: MSEKKQTVDLGLLEEDDEFEEFPAEDWTGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS.
For Research Use Only | Not For Clinical Use.
Online Inquiry