Mouse Anti-slc30a6 Antibody (CBMOAB-05909FYB)


Cat: CBMOAB-05909FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05909FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa) WB, ELISA MO05909FYB 100 µg
MO-AB-20366R Monoclonal Cattle (Bos taurus) WB, ELISA MO20366R 100 µg
MO-AB-30129R Monoclonal Pig (Sus scrofa) WB, ELISA MO30129R 100 µg
MO-AB-64610W Monoclonal Marmoset WB, ELISA MO64610W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Pig (Sus scrofa)
CloneMO05909FYB
SpecificityThis antibody binds to Zebrafish slc30a6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of proteins that function as zinc transporters. This protein can regulate subcellular levels of zinc in the Golgi and vesicles. Expression of this gene is altered in the Alzheimer's disease brain plaques. (From NCBI)
Product OverviewMouse Anti-Zebrafish slc30a6 Antibody is a mouse antibody against slc30a6. It can be used for slc30a6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc transporter 6; ZnT-6; Solute carrier family 30 member 6; slc30a6; znt
UniProt IDQ6P0D1
Protein RefseqThe length of the protein is 486 amino acids long.
The sequence is show below: MVALDVLGITDSDAPVYRQKQEADTLVLGTIHPFRKAHRSVLGKLAQEFRLVTSDRRSWKILLFGVLNVVCTGCLLMWCSSTNSMALTAYTYLTIFDLFSLITCLLSLWVTMKKPSQIYSFGFQRFEVLAVFSSTVLVQLGSLFILKESVERFVEQPEVHTGRLLVGTFVALFFNLLTLLSVKNKPFVFVSEAASTSWLQEHVADLSRSLCGLIPALSSFLLPRMNPFVLINLAGAFALGITYMLIEINNYNAMDTASAVAIALMTFGTMYPMSVYSGKVLLQTTPSHVIGQLDKLLREVSTLDGVLEVRNEHFWTIGFGSLAGSVHVRIRRDADEQMVLAHVWNRLSALVSALTVHVFKDEWSRASLSSGVLPSAPLSLSEYVTAAAVFPAAPSRAQGSEPTPATSTPAKPSSPPPEFSFHTPGRHVQPVVFQTAHPHRPLYGGLQGPGVRLGLGPRGPTLQAYRTLSAAPHTYTSGTYTGPPRP.
For Research Use Only | Not For Clinical Use.
Online Inquiry