AibGenesis™ Mouse Anti-smim19 Antibody (CBMOAB-06524FYB)


Cat: CBMOAB-06524FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06524FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO06524FYB 100 µg
MO-AB-12103W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12103W 100 µg
MO-AB-20602R Monoclonal Cattle (Bos taurus) WB, ELISA MO20602R 100 µg
MO-AB-29029H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29029C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO06524FYB
SpecificityThis antibody binds to Zebrafish smim19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSMIM19 (Small Integral Membrane Protein 19) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish smim19 Antibody is a mouse antibody against smim19. It can be used for smim19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall integral membrane protein 19; smim1
UniProt IDQ4V921
Protein RefseqThe length of the protein is 104 amino acids long.
The sequence is show below: MGGYGVMADEESLDYSVHEAWNEATNVYLLVILVSFALLMYARKNKRKIMRIFTLPPTVGSSSEPNFYDSLQKVRLRQQLEMYSLARKYDQQQSQSESVQLSME.
For Research Use Only | Not For Clinical Use.
Online Inquiry