Mouse Anti-smim7 Antibody (CBMOAB-06525FYB)


Cat: CBMOAB-06525FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06525FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO06525FYB 100 µg
MO-AB-19333W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19333W 100 µg
MO-AB-20605R Monoclonal Cattle (Bos taurus) WB, ELISA MO20605R 100 µg
MO-AB-29037H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29037C 100 µg
MO-AB-64926W Monoclonal Marmoset WB, ELISA MO64926W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO06525FYB
SpecificityThis antibody binds to Zebrafish smim7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish smim7 Antibody is a mouse antibody against smim7. It can be used for smim7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall integral membrane protein 7; smim
UniProt IDA5PLC9
Protein RefseqThe length of the protein is 77 amino acids long.
The sequence is show below: MIGDLLIFGTLLMNAGAVLNFKLKKRETQSQGFGDDSGSSSTGENIREFLLSLRYFRIFIALWNIFMMFCMIVLFGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry