AibGenesis™ Mouse Anti-snn Antibody (CBMOAB-06685FYB)
Cat: CBMOAB-06685FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06685FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Rat (Rattus norvegicus) | WB, ELISA | MO06685FYB | 100 µg | ||
| MO-AB-07877H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07877C | 100 µg | ||
| MO-AB-18811W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18811W | 100 µg | ||
| MO-AB-20659R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20659R | 100 µg | ||
| MO-AB-29066H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29066C | 100 µg | ||
| MO-AB-35733W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35733W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Rat (Rattus norvegicus) |
| Clone | MO06685FYB |
| Specificity | This antibody binds to Zebrafish snn. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | SNN (Stannin) is a Protein Coding gene. |
| Product Overview | Mouse Anti-Zebrafish snn Antibody is a mouse antibody against snn. It can be used for snn detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Stannin; sn |
| UniProt ID | Q6P957 |
| Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MSITDHSPTTGVVTIIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGEGETKEPFLLVQYSARGPRVEHKTKLTPNGTESHT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry