Mouse Anti-spg21 Antibody (CBMOAB-07105FYB)


Cat: CBMOAB-07105FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07105FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Sheep (Ovis aries) WB, ELISA MO07105FYB 100 µg
MO-AB-13314Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13314Y 100 µg
MO-AB-17596W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17596W 100 µg
MO-AB-17766Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17766Y 100 µg
MO-AB-20815R Monoclonal Cattle (Bos taurus) WB, ELISA MO20815R 100 µg
MO-AB-65205W Monoclonal Marmoset WB, ELISA MO65205W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Sheep (Ovis aries)
CloneMO07105FYB
SpecificityThis antibody binds to Zebrafish spg21.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. Mutations in this gene are associated with autosomal recessive spastic paraplegia 21 (SPG21), also known as mast syndrome. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish spg21 Antibody is a mouse antibody against spg21. It can be used for spg21 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMaspardin; Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog; spg2
UniProt IDQ6PC62
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MEEIRVSPDYNWFRSTVPLKRIIVDDDDSKVWSLYDAGPKSIRCPIIFLPPVSGTAEVFFQQVLALSGWGYRVISLQYPVYWDLLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEVTYKSPRVHSLVLCNSFSDTSIFNQTWTANSFWLMPSFMLKKIVLGNFAKGPVDPKMADAIDFMVDRLESLNQSELASRLTLNCQNSYVEPHKIKDIAVTIMDVFDQSALSQEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYIQIHLRQFHGTRYAAISPEMVSAEELEVQRTHLSNNSESEDES.
For Research Use Only | Not For Clinical Use.
Online Inquiry