Mouse Anti-stm Antibody (CBMOAB-07826FYB)


Cat: CBMOAB-07826FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07826FYB Monoclonal Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana) WB, ELISA MO07826FYB 100 µg
CBMOAB-41845FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO41845FC 100 µg
MO-DKB-0516RA Polyclonal A. thaliana (Arabidopsis thaliana) WB 50 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana)
CloneMO07826FYB
SpecificityThis antibody binds to Zebrafish stm.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEssential for the formation of otoliths in the inner ear of developing larvae and for the perception of gravity and acceleration. May be one of the organic components of the ortholiths.
Product OverviewMouse Anti-Zebrafish stm Antibody is a mouse antibody against stm. It can be used for stm detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein starmaker; st
UniProt IDA2VD23
Protein RefseqThe length of the protein is 613 amino acids long.
The sequence is show below: MLSRTVFVPLILAFVGVSISAPVSNNNGTDNDESAADQRHIFTVQFNVGTPAPADGDSVTTDGKDSAEKNEAPGDSSDTTEKPGTTDGKDSAEQHGVTTDGKDEAEQHGVTTDGQDSAEKRGEADGAPDKPDTQNGTDDTDSDQETDASHHKTGDSDENKDKPSAEDHTDGNHAGKDSTDSKESPDTTDKPEGPDSDSAPDGDSASAEKTDSDHSPDEDANKSSTEADKDDTSDKDSSQTDEKHDSDASDKDEKHEDKDEKSDEKDSSKDSEDKSQEKSDKSDDGSNSEADEQKESVESKDHDSDSQDSDSAEKKEKHDDKDQDSSDSADSKDSDEDKDKDHSEQKDSEDHEHKEKHTKDKEEHKDSDEGKDDEDKSKSDEHDKDESESKEASKSDESEQEEKKDDKSDSDNSSRDSHSDSDSDSHSDSDSDSHSDSHSDSDSDSHSDSDSDSDSDSDSDSDSDSDSNSRDKDEKKDKSSESRDEDSSDSDSKSNSESSETAEEDTNDDKDSSVEKDKTDSSDSASVEANDSDDEHDDDSKDATPSSEDHTAEKTDEDSHDVSDDDDDIDAHDDEAGVEHGTDEASKPHQEPDHHDDTTHGSDDGRKTSMPIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry