Mouse Anti-tagln Antibody (CBMOAB-08580FYB)


Cat: CBMOAB-08580FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08580FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO08580FYB 100 µg
Inquiry
CBMOAB-59705FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59705FYA 100 µg
Inquiry
MO-AB-01490L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01490L 100 µg
Inquiry
MO-AB-08251H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08251C 100 µg
Inquiry
MO-AB-12862W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12862W 100 µg
Inquiry
MO-AB-17848Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17848Y 100 µg
Inquiry
MO-AB-21246R Monoclonal Cattle (Bos taurus) WB, ELISA MO21246R 100 µg
Inquiry
MO-AB-29347H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29347C 100 µg
Inquiry
MO-AB-33611W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33611W 100 µg
Inquiry
MO-AB-35795W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35795W 100 µg
Inquiry
MO-AB-65817W Monoclonal Marmoset WB, ELISA MO65817W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO08580FYB
SpecificityThis antibody binds to Zebrafish tagln.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization.
Product OverviewMouse Anti-Zebrafish tagln Antibody is a mouse antibody against tagln. It can be used for tagln detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSM22 alpha-b; tagl
UniProt IDQ29VH8
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MANKGPSYGLSRQVQDKIEQKYDPELELRLVEWLVAQCGSAVGRPDAGKLGFQAWLKDGCVLCELINSLSKEKPVKKIQSSSMAFKQMEQVSQFLNAAEQYGVAKTDIFQTVDLWEGKDLAAVQRTLMALGSIAVTKEDGAFRGDPNWFFKKAQENRRDFSDDQMKEGKNVIGLQMGSKRGASQAGMTGYGRPRQIMNP.
For Research Use Only | Not For Clinical Use.
Online Inquiry