Mouse Anti-tarsl2 Antibody (CBMOAB-08636FYB)


Cat: CBMOAB-08636FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08636FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO08636FYB 100 µg
CBMOAB-59739FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59739FYA 100 µg
MO-AB-10549W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10549W 100 µg
MO-AB-65853W Monoclonal Marmoset WB, ELISA MO65853W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO08636FYB
SpecificityThis antibody binds to Zebrafish tarsl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tarsl2 Antibody is a mouse antibody against tarsl2. It can be used for tarsl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestarsl2; TARSL2 Gene(Protein Coding) Threonyl-TRNA Synthetase Like 2
UniProt IDB8JMZ8
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: DGDDRDRPVIIHRAILGSVERMIAILTENYAGKWPLWLSPRQVMLVPVNPSLEEYAKQVCKRFVEAGFMADADLDSSCLLNKKIRNAQLAQYNFILVVGEKERLSNSVNVRTRDNKVHGELPVLEVMERLMLLRRSQCRNAEDDF.
For Research Use Only | Not For Clinical Use.
Online Inquiry