Mouse Anti-tcta Antibody (CBMOAB-08954FYB)


Cat: CBMOAB-08954FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08954FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO08954FYB 100 µg
MO-AB-15183W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15183W 100 µg
MO-AB-21392R Monoclonal Cattle (Bos taurus) WB, ELISA MO21392R 100 µg
MO-AB-29391H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29391C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO08954FYB
SpecificityThis antibody binds to Zebrafish tcta.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tcta Antibody is a mouse antibody against tcta. It can be used for tcta detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell leukemia translocation-altered gene protein homolog; tct
UniProt IDQ6DGY3
Protein RefseqThe length of the protein is 100 amino acids long.
The sequence is show below: MEESWDFEFLSRMVDSLVSFLSEFVDDWLANDMRVAVFKILFSWLVVSLVAIHFAWKVYGNTVNDMYYRQGTGGQNGGTPDTHLSGWESAAGDAMKTHRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry