Mouse Anti-tegt Antibody (CBMOAB-09054FYB)


Cat: CBMOAB-09054FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09054FYB Monoclonal Zebrafish (Danio rerio), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO09054FYB 100 µg
MO-AB-29399H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29399C 100 µg
MO-AB-30617R Monoclonal Pig (Sus scrofa) WB, ELISA MO30617R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO09054FYB
SpecificityThis antibody binds to Zebrafish tegt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tegt Antibody is a mouse antibody against tegt. It can be used for tegt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestegt
UniProt IDE7F1Q5
Protein RefseqThe length of the protein is 236 amino acids long.
The sequence is show below: MNVFDRNINFDALFKFSQISRSTQQHLKNVYASLAVCMLVATAGSYIYVVTRIFQGGLTMLGSLAMMAWLAMTPHSPQTEKKRLAILAAFAFFTGLGLGPLMDYAISIDPSIIVTAFLGTSIIFSCFTLSALYAQRRSYLFLGGTLMTGLTVLLLVSILNMFFGSVLIFKAHLYLGLLVMCGFVLFDTQLIIEKAEMGDKDYIWHCVDLFLDFVTIFRKLVILLSMNEKEKKKEKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry