Mouse Anti-tfpt Antibody (CBMOAB-09236FYB)


Cat: CBMOAB-09236FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09236FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, ELISA MO09236FYB 100 µg
CBMOAB-60107FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60107FYA 100 µg
MO-AB-08391H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08391C 100 µg
MO-AB-10192Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10192Y 100 µg
MO-AB-16248W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16248W 100 µg
MO-AB-21484R Monoclonal Cattle (Bos taurus) WB, ELISA MO21484R 100 µg
MO-AB-66093W Monoclonal Marmoset WB, ELISA MO66093W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta)
CloneMO09236FYB
SpecificityThis antibody binds to Zebrafish tfpt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tfpt Antibody is a mouse antibody against tfpt. It can be used for tfpt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestfpt; TFPT Gene(Protein Coding) TCF3 Fusion Partner
UniProt IDE7F6W8
Protein RefseqThe length of the protein is 194 amino acids long.
The sequence is show below: MMEDFSGLALPPLFGGHILEAELETGGVELGPGGTELLETDGAPSGSGDEERRELDRNKYQTLSKRCKEIQQVNEKILGRLHQVQRLTRRMRKERRFLMKTLDSYGDDYRAAQLTITLEHHHKLYLEDEGKAVESALGGDEDVSSPTFPPQSTGGAKRKRHRLQKDRDTQIESEQPVMTEAQFSGFPSPNSLSH.
For Research Use Only | Not For Clinical Use.
Online Inquiry