AibGenesis™ Mouse Anti-thap3 Antibody (CBMOAB-09309FYB)


Cat: CBMOAB-09309FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09309FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09309FYB 100 µg
MO-AB-21517R Monoclonal Cattle (Bos taurus) WB, ELISA MO21517R 100 µg
MO-AB-21587W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21587W 100 µg
MO-AB-29441H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29441C 100 µg
MO-AB-66135W Monoclonal Marmoset WB, ELISA MO66135W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO09309FYB
SpecificityThis antibody binds to Zebrafish thap3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish thap3 Antibody is a mouse antibody against thap3. It can be used for thap3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHAP domain containing, apoptosis associated protein 3; Thap3 protein; thap
UniProt IDQ58EG0
Protein RefseqThe length of the protein is 213 amino acids long.
The sequence is show below: MPKSCSASNCTNRYNNKNPEITFHRFPFSKPSVLKQWLDNIGRDDFQPRKHMVICSLHFTPDCFSGLGNRKNLLWNAVPTLFAVPTQDANQNNFRKRLKRALQSASEKWDGITPDGLPLFTEEMHEDTQDCNNNEVADCQSTKVFAAADHTYALSDACTTKARLFNILDANRWLRKRLQAKCRVIKRMKLKLKDAQRELLTLRQQIRHRHVNH.
For Research Use Only | Not For Clinical Use.
Online Inquiry