Mouse Anti-thumpd2 Antibody (CBMOAB-09385FYB)


Cat: CBMOAB-09385FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09385FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO09385FYB 100 µg
CBMOAB-60213FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60213FYA 100 µg
MO-AB-08426H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08426C 100 µg
MO-AB-23487W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23487W 100 µg
MO-AB-66177W Monoclonal Marmoset WB, ELISA MO66177W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO09385FYB
SpecificityThis antibody binds to Zebrafish thumpd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish thumpd2 Antibody is a mouse antibody against thumpd2. It can be used for thumpd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesthumpd2; THUMPD2 Gene(Protein Coding) THUMP Domain Containing 2
UniProt IDF1R289
Protein RefseqThe length of the protein is 449 amino acids long.
The sequence is show below: KMRQLYCTAGAGMEELLAQEVRQKLCASQVEQIPGRVFFSTNAEPQTLTQLKSAERLFLLLHKAEPIALPNNPGKAAAVIKERVVGDPDIWKQTLLSWTAFQEELECRRDQGHKRKREEDEEESVIEADGSTHTVSSNTHLLERQKEVGKESHLQTPSFRVSCRCSGVIARSNNPQRLSRIIGMAIKEQLGWKVDLREPVLEHNQVNVYLSDDHCIVGIPLLKHPLASRSYMKHNGLRSTIAWAMTSLCPDELNNCVILDPMCGVGAVLLEAAQEYSNAVFLGMDTDGSQLQKAAENVKASGMEGRVQLLQSSALEIPLADGMVDAVLCDVPFGRKFSCSSDMTTALPLLLREMERVLRVGGHLVLLLSLQLSAQLKKIICTPEQEKHSKSLDTNSVHTEPSNAHKESTETHKTLLISSLQSQKKHRVSLGSTDAFIHIYTKMQTQTHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry