Mouse Anti-tlcd1 Antibody (CBMOAB-09497FYB)


Cat: CBMOAB-09497FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09497FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09497FYB 100 µg
MO-AB-06549W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06549W 100 µg
MO-AB-21632R Monoclonal Cattle (Bos taurus) WB, ELISA MO21632R 100 µg
MO-AB-21802W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21802W 100 µg
MO-AB-29480H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29480C 100 µg
MO-AB-66245W Monoclonal Marmoset WB, ELISA MO66245W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09497FYB
SpecificityThis antibody binds to Zebrafish tlcd1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tlcd1 Antibody is a mouse antibody against tlcd1. It can be used for tlcd1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTLC domain containing 1; tlcd
UniProt IDQ5XJP8
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MDTWLNEVQKFPVLYVLCCSVLFRILHWCLQIVARPDTVTKDRWKTWKWRNLSVSLVHSLLTGTWAVACVIYYPAMVHEIHSTYTPSAYMLVVVSSGYFIEDAADIVFSGHAKASWEFLLHHVLVLWCFLYAVFTHQYVAGAVVALFVEVNSVFLHTRLLLNLAKVAHSSLIYTVNKVLNVVTYVTFRLGAQFYLTWYLTYHYSSLDYALYFLITTMLMNIMILIYFYRLIRSDFFTKRRIQNGIQKLAAD.
For Research Use Only | Not For Clinical Use.
Online Inquiry