AibGenesis™ Mouse Anti-tm2d3 Antibody (CBMOAB-09610FYB)


Cat: CBMOAB-09610FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09610FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09610FYB 100 µg
MO-AB-12088W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12088W 100 µg
MO-AB-21699R Monoclonal Cattle (Bos taurus) WB, ELISA MO21699R 100 µg
MO-AB-29492H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29492C 100 µg
MO-AB-66280W Monoclonal Marmoset WB, ELISA MO66280W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO09610FYB
SpecificityThis antibody binds to Zebrafish tm2d3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. Several alternatively spliced transcript variants of this gene are described but the full length nature of some variants has not been determined. Multiple polyadenylation sites have been found in this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tm2d3 Antibody is a mouse antibody against tm2d3. It can be used for tm2d3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTM2 domain-containing protein 3; tm2d
UniProt IDB8JMZ7
Protein RefseqThe length of the protein is 244 amino acids long.
The sequence is show below: MSSYIMLVLLLLDIYSSCVDGYLSSPHVGQDPPYLAQQKSVMSSPVAMTASSASPVVTDNYVSKCPSGGLCSKLPADCIICALHHNCSYGRPHNYTCRPRAGVHCVSDQGERQQNFTLSLLCRFCFQLDASQYRCSNSSDCMTVSCPRRRYNASCEVLEHVHCLGKRVFQKRLFCNWTGGYKWSTALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLHI.
For Research Use Only | Not For Clinical Use.
Online Inquiry