Mouse Anti-tmco1 Antibody (CBMOAB-09663FYB)


Cat: CBMOAB-09663FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09663FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Horse (Equus caballus), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) WB, ELISA MO09663FYB 100 µg
MO-AB-08497H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08497C 100 µg
MO-AB-13479Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13479Y 100 µg
MO-AB-21734R Monoclonal Cattle (Bos taurus) WB, ELISA MO21734R 100 µg
MO-AB-29503H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29503C 100 µg
MO-AB-46842W Monoclonal Horse (Equus caballus) WB, ELISA MO46842W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Horse (Equus caballus), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus)
CloneMO09663FYB
SpecificityThis antibody binds to Zebrafish tmco1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmco1 Antibody is a mouse antibody against tmco1. It can be used for tmco1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTmco1 protein; Transmembrane and coiled-coil domains 1; tmco
UniProt IDQ6DGW9
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: MSTMFADTILIVFISICTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFVPLSYIQGLSHRNLLGEDYTDCSFIFLYILCTMSIRQNIQKMLGLAPSRAATKQAGGFLGPPPQAAKFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry