AibGenesis™ Mouse Anti-tmed4 Antibody (CBMOAB-09675FYB)


Cat: CBMOAB-09675FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09675FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09675FYB 100 µg
MO-AB-08501H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08501C 100 µg
MO-AB-12297W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12297W 100 µg
MO-AB-21743R Monoclonal Cattle (Bos taurus) WB, ELISA MO21743R 100 µg
MO-AB-29510H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29510C 100 µg
MO-AB-66322W Monoclonal Marmoset WB, ELISA MO66322W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO09675FYB
SpecificityThis antibody binds to Zebrafish tmed4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmed4 Antibody is a mouse antibody against tmed4. It can be used for tmed4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmed4; TMED4 Gene(Protein Coding) Transmembrane P24 Trafficking Protein 4
UniProt IDF1R3P1
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MIWMEMKTLVSCVGFLLLFVWLSPSQALYFHIGETEKKCFIEEIPDETMVIGRYRTQLWDKQAGSFLPSTPGLGMHVEIKDPETKVILSRQYGSDGRFTFTSHTPGEHQICLHSNSTKMALFAGGKLRVHLDIQVGEHTNNYPEIAAKDKLTELQLRVRQLLDQVEQIQKEQNYQRYREERFRMTSESTNQRVLWWSIAQTVILIITGIWQMKHLKSFFEAKKLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry