Mouse Anti-tmem150a Antibody (CBMOAB-09768FYB)


Cat: CBMOAB-09768FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09768FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO09768FYB 100 µg
CBMOAB-60464FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60464FYA 100 µg
MO-AB-25222W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25222W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO09768FYB
SpecificityThis antibody binds to Zebrafish tmem150a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem150a Antibody is a mouse antibody against tmem150a. It can be used for tmem150a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 150; tmem150a; tmem15
UniProt IDQ0P401
Protein RefseqThe length of the protein is 293 amino acids long.
The sequence is show below: MTAWIILPVSLAAFSITGIWIVYAMAVMNHHVCPVENWSYNVTCTEETAKPGFPKTCCTLQDIPLISKCGSYPPESCLFSLIGNVGAFMVVMVCLLRYAQIIEHRNHCWLNTSGLVSGCTNAVGLVMVGNFQVDHAKTLHYVGAGAAFPAGILFVCLQCLLTYRVAVTALDYWMAHVRVALATGALITLVLSGIFFIHESFVLQHAAAICEWVFTVVILIFYGTFTYEFGTVTTETMLAGLQRNLSHGPGVMIGDDVQAGTLGSSTTTKSLKSPGGSSTSTHLNCTPENIAML.
For Research Use Only | Not For Clinical Use.
Online Inquiry