AibGenesis™ Mouse Anti-tmem199 Antibody (CBMOAB-09863FYB)


Cat: CBMOAB-09863FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09863FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09863FYB 100 µg
MO-AB-08531H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08531C 100 µg
MO-AB-13828W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13828W 100 µg
MO-AB-21828R Monoclonal Cattle (Bos taurus) WB, ELISA MO21828R 100 µg
MO-AB-29563H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29563C 100 µg
MO-AB-35854W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35854W 100 µg
MO-AB-66445W Monoclonal Marmoset WB, ELISA MO66445W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO09863FYB
SpecificityThis antibody binds to Zebrafish tmem199.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene has been observed to localize to the endoplasmic reticulum (ER)-Golgi intermediate compartment (ERGIC) and coat protein complex I (COPI) in some human cells. The encoded protein shares some homology with the yeast protein Vma12. Defects in this gene are a cause of congenital disorder of glycosylation, type IIp. (From NCBI)
Product OverviewMouse Anti-Zebrafish tmem199 Antibody is a mouse antibody against tmem199. It can be used for tmem199 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:109974; tmem199; zgc:10997
UniProt IDQ504B0
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MASSFKIGERFKERLRDLLESKSAISEELKEELKTFKDQSIIPFKTVRKLHKLLQDNGHPVHLHELFEDSTLHLPEVITPPRNPQLVARLEKIKAKLANEEYKRITRNVNPQEINQHGTLADFGRQVRSVKAVVVTVFNFLVTVIAAFACSYLGSQYIFTETTARVIAAVIAASVVGLAELYVLVRTMEGDLEEP.
For Research Use Only | Not For Clinical Use.
Online Inquiry