AibGenesis™ Mouse Anti-tmem229b Antibody (CBMOAB-09898FYB)


Cat: CBMOAB-09898FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09898FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09898FYB 100 µg
MO-AB-13477W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13477W 100 µg
MO-AB-21847R Monoclonal Cattle (Bos taurus) WB, ELISA MO21847R 100 µg
MO-AB-29585H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29585C 100 µg
MO-AB-66472W Monoclonal Marmoset WB, ELISA MO66472W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO09898FYB
SpecificityThis antibody binds to Zebrafish tmem229b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem229b Antibody is a mouse antibody against tmem229b. It can be used for tmem229b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 229b; tmem229
UniProt IDX1WD70
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MVTMATTVTPEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNCNWKFPGVTSVWALFIYGTCILIVERMYLCLKDRCNVLLRCIIYTLWTYFWEFGTGFLLRQFNACPWDYSEFKYNFMGLITAEYAVPWFCASFIVERLVIRNTLRLRFDEVAESGQAEERLDRGGGGRGGRRGRGARAGATSANGYVKVD.
For Research Use Only | Not For Clinical Use.
Online Inquiry