Mouse Anti-tmem50a Antibody (CBMOAB-09981FYB)


Cat: CBMOAB-09981FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09981FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09981FYB 100 µg
MO-AB-08548H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08548C 100 µg
MO-AB-21886R Monoclonal Cattle (Bos taurus) WB, ELISA MO21886R 100 µg
MO-AB-23717W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23717W 100 µg
MO-AB-29614H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29614C 100 µg
MO-AB-66519W Monoclonal Marmoset WB, ELISA MO66519W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO09981FYB
SpecificityThis antibody binds to Zebrafish tmem50a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem50a Antibody is a mouse antibody against tmem50a. It can be used for tmem50a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTmem50a protein; Transmembrane protein 50A; tmem50a; NP_998694.
UniProt IDQ803R8
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: MSGFLDGIRCGDCECNVDWGEKRNTIASIAAGVLFFTGWWIIIDAAIMYPKEEQFHHAYHTCGVIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFIGFMLAFGSLIASMWILFGGFVVTGTEHKDLSVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry