Mouse Anti-tmem70 Antibody (CBMOAB-10021FYB)


Cat: CBMOAB-10021FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10021FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO10021FYB 100 µg
MO-AB-19765W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19765W 100 µg
MO-AB-21901R Monoclonal Cattle (Bos taurus) WB, ELISA MO21901R 100 µg
MO-AB-29623H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29623C 100 µg
MO-AB-66546W Monoclonal Marmoset WB, ELISA MO66546W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO10021FYB
SpecificityThis antibody binds to Zebrafish tmem70.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem70 Antibody is a mouse antibody against tmem70. It can be used for tmem70 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem70; TMEM70 Gene(Protein Coding) Transmembrane Protein 70
UniProt IDF1Q9S8
Protein RefseqThe length of the protein is 268 amino acids long.
The sequence is show below: GILHGLRRLSKIQQQIIRNVQIGVRPASLSDGNVCSSRVALLTRQDDLLHVMRRSFLKAHANKVQSCCAVRWYNSSPVQSEDGDLIYSGNLGKAIRGKYTTYNVKYNQPMTSYCQISNLIVQICSFVEGVKLFSYSSSMFSLCVMPFVLMKTGMGVNSLALQVAFCGVIGFFTFLTPALLHFITKGYVIRLYHNKETDMYTAITYSAVLLEKRTVFHQSDVTIPDVSRMFTSFYAKKRSMLVNPMHFSLPHDYNHLMGYDRPFSFDMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry