Mouse Anti-tmx4 Antibody (CBMOAB-10141FYB)


Cat: CBMOAB-10141FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10141FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO10141FYB 100 µg
MO-AB-12093W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12093W 100 µg
MO-AB-21951R Monoclonal Cattle (Bos taurus) WB, ELISA MO21951R 100 µg
MO-AB-29649H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29649C 100 µg
MO-AB-66596W Monoclonal Marmoset WB, ELISA MO66596W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO10141FYB
SpecificityThis antibody binds to Zebrafish tmx4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and C-terminal ASP/GLU-rich calcium binding domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The encoded protein has been shown to have reductase activity in vitro. (From NCBI)
Product OverviewMouse Anti-Zebrafish tmx4 Antibody is a mouse antibody against tmx4. It can be used for tmx4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:112303; tmx4; zgc:11230
UniProt IDQ4KMD4
Protein RefseqThe length of the protein is 277 amino acids long.
The sequence is show below: MQKYDRGFLWISALFLTLAGRGDAQADASNVVTVADANWTLILQGEWMIKFYAPWCPACQHLQADWENLGRQSDSLGISVGRVDVTQQPGLSGRFLVTTLPTIFHAKNGDFRKYVSSRTIEDIQAYVVHRKWATVEPVPGWKSPSSLLMSGMAHLFRLSVWIRQIHTYLTNTLGIPSWGSYVIFAIITLFMGLVLGLMLVLIADCIWPSRPKRRQDQTVVTVKEDVSEEEEEEKQDLESERVSEESTEEETADADADTDAETTVRRRVQNKSTTEGT.
For Research Use Only | Not For Clinical Use.
Online Inquiry