Mouse Anti-tnfaip8l1 Antibody (CBMOAB-10167FYB)


Cat: CBMOAB-10167FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10167FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO10167FYB 100 µg
CBMOAB-60701FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60701FYA 100 µg
MO-AB-04519Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04519Y 100 µg
MO-AB-15427W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15427W 100 µg
MO-AB-21957R Monoclonal Cattle (Bos taurus) WB, ELISA MO21957R 100 µg
MO-AB-29655H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29655C 100 µg
MO-AB-66604W Monoclonal Marmoset WB, ELISA MO66604W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO10167FYB
SpecificityThis antibody binds to Zebrafish tnfaip8l1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tnfaip8l1 Antibody is a mouse antibody against tnfaip8l1. It can be used for tnfaip8l1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTumor necrosis factor alpha-induced protein 8-like protein 1; TIPE1; TNF alpha-induced protein 8-like protein 1; TNFAIP8-like protein 1; tnfaip8l1; tnfaip
UniProt IDQ7SZE8
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: MDSFSTKNLALQAQKKLMSKMATKTVANLFIDDTSSEVLDELYRVTKEYTRNRKEAQKIIKNLIKMVVKLGVLYRNGQFNNEELALVERFRKKVHTLAMTAVSFYQIDFTFDRRVMSNLLNDCRELLHQAINRHLTAKSHARINHVFNHFADCDFLATLYGPSEVYRGHLQKICEGVNKMLDEGNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry