AibGenesis™ Mouse Anti-trappc3 Antibody (CBMOAB-10625FYB)


Cat: CBMOAB-10625FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10625FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO10625FYB 100 µg
MO-AB-08688H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08688C 100 µg
MO-AB-10307Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10307Y 100 µg
MO-AB-22126R Monoclonal Cattle (Bos taurus) WB, ELISA MO22126R 100 µg
MO-AB-24507W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24507W 100 µg
MO-AB-29744H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29744C 100 µg
MO-AB-66833W Monoclonal Marmoset WB, ELISA MO66833W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO10625FYB
SpecificityThis antibody binds to Zebrafish trappc3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus; Endoplasmic reticulum; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. The encoded protein participates in the regulation of transport from the endoplasmic reticulum to the Golgi apparatus. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish trappc3 Antibody is a mouse antibody against trappc3. It can be used for trappc3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:101005; trappc3; zgc:10100
UniProt IDQ6DC31
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MSRQSNRATDSKKMNSELFTLTYGALVTQLCKDYENDEEVNKQLDKMGYNIGVRLIEDFLARSSVGRCHDFRETADVIAKIAFKMYLGITPSVTNWSPAGDEFSLILESNPLVDFVELPDNHSNLVYSNLLCGVLRGALEMVQMAVDVRFTQDTLRGDNVTEIRMKFIKRIEENLPAGDE.
For Research Use Only | Not For Clinical Use.
Online Inquiry