Mouse Anti-triap1 Antibody (CBMOAB-10655FYB)
Cat: CBMOAB-10655FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-10655FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset | WB, ELISA | MO10655FYB | 100 µg | ||
MO-AB-21154W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21154W | 100 µg | ||
MO-AB-22160R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22160R | 100 µg | ||
MO-AB-35876W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35876W | 100 µg | ||
MO-AB-46905W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46905W | 100 µg | ||
MO-AB-66853W | Monoclonal | Marmoset | WB, ELISA | MO66853W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset |
Clone | MO10655FYB |
Specificity | This antibody binds to Zebrafish triap1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Zebrafish triap1 Antibody is a mouse antibody against triap1. It can be used for triap1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Zgc:112025 protein; triap1; zgc:11202 |
UniProt ID | Q567I3 |
Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: MNSVGEGCTELKRECDQCFNRWFAEKFLKGDRSADPCSELFNKYHTCVQKAIKEKDIPIEGVEFMGPNSEKADS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry