AibGenesis™ Mouse Anti-tsen15 Antibody (CBMOAB-10984FYB)


Cat: CBMOAB-10984FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10984FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO10984FYB 100 µg
MO-AB-15912W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15912W 100 µg
MO-AB-22264R Monoclonal Cattle (Bos taurus) WB, ELISA MO22264R 100 µg
MO-AB-29794H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29794C 100 µg
MO-AB-66990W Monoclonal Marmoset WB, ELISA MO66990W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO10984FYB
SpecificityThis antibody binds to Zebrafish tsen15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. (From NCBI)
Product OverviewMouse Anti-Zebrafish tsen15 Antibody is a mouse antibody against tsen15. It can be used for tsen15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSimilar to chromosome 1 open reading frame 19; tsen15; LOC10000506
UniProt IDA5WV68
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MDEANPANPPPNWIQQHTVYQELMRLEVGDSVQVHAAFLVYMDLTEVRKWKDVVGVSCPELQAVLLEGREKEGESVQMIYPLPSHRSIKHRELRSILDRGSPMLLCAVASDSTLVYQRLCDGFLTPDPPVDIQDQGRRQHRKRRLQT.
For Research Use Only | Not For Clinical Use.
Online Inquiry