Mouse Anti-tspan9 Antibody (CBMOAB-11061FYB)
Cat: CBMOAB-11061FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-11061FYB | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO11061FYB | 100 µg | ||
CBMOAB-61384FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO61384FYA | 100 µg | ||
MO-AB-01565L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01565L | 100 µg | ||
MO-AB-04632Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04632Y | 100 µg | ||
MO-AB-08051W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08051W | 100 µg | ||
MO-AB-13329W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13329W | 100 µg | ||
MO-AB-18086Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18086Y | 100 µg | ||
MO-AB-33872W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33872W | 100 µg | ||
MO-AB-33949H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33949C | 100 µg | ||
MO-AB-35901W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35901W | 100 µg | ||
MO-AB-46937W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46937W | 100 µg | ||
MO-AB-67035W | Monoclonal | Marmoset | WB, ELISA | MO67035W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
Clone | MO11061FYB |
Specificity | This antibody binds to Zebrafish tspan9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma Membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Alternatively spliced transcripts encoding the same protein have been identified. (From NCBI) |
Product Overview | Mouse Anti-Zebrafish tspan9 Antibody is a mouse antibody against tspan9. It can be used for tspan9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tetraspanin-9; Tspan-9; tspan |
UniProt ID | Q6GMK6 |
Protein Refseq | The length of the protein is 239 amino acids long. The sequence is show below: MARGCLCCVKYMMFLFNLLFWLSGCGLLGVGIWLSVSQGSFATFSPSFPSLSAANLVITLGSVVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYTEKVSENAKQDLKDGLRLYNTDNNVGLRNAWNIIQAEWQCCGVTGLSDWHEALQEKSVPDRCCQEHYTECGRNTTNVFWSQGCYEKVEEWLNDNKHLLGTIAMCVLVLQLLGMAFSMTLYQQIHRAGKKYDA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry