Mouse Anti-tspan9 Antibody (CBMOAB-11061FYB)


Cat: CBMOAB-11061FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11061FYB Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO11061FYB 100 µg
CBMOAB-61384FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61384FYA 100 µg
MO-AB-01565L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01565L 100 µg
MO-AB-04632Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04632Y 100 µg
MO-AB-08051W Monoclonal Cat (Felis catus) WB, ELISA MO08051W 100 µg
MO-AB-13329W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13329W 100 µg
MO-AB-18086Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18086Y 100 µg
MO-AB-33872W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33872W 100 µg
MO-AB-33949H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33949C 100 µg
MO-AB-35901W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35901W 100 µg
MO-AB-46937W Monoclonal Horse (Equus caballus) WB, ELISA MO46937W 100 µg
MO-AB-67035W Monoclonal Marmoset WB, ELISA MO67035W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO11061FYB
SpecificityThis antibody binds to Zebrafish tspan9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Alternatively spliced transcripts encoding the same protein have been identified. (From NCBI)
Product OverviewMouse Anti-Zebrafish tspan9 Antibody is a mouse antibody against tspan9. It can be used for tspan9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTetraspanin-9; Tspan-9; tspan
UniProt IDQ6GMK6
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MARGCLCCVKYMMFLFNLLFWLSGCGLLGVGIWLSVSQGSFATFSPSFPSLSAANLVITLGSVVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYTEKVSENAKQDLKDGLRLYNTDNNVGLRNAWNIIQAEWQCCGVTGLSDWHEALQEKSVPDRCCQEHYTECGRNTTNVFWSQGCYEKVEEWLNDNKHLLGTIAMCVLVLQLLGMAFSMTLYQQIHRAGKKYDA.
For Research Use Only | Not For Clinical Use.
Online Inquiry