Mouse Anti-ttpa Antibody (CBMOAB-11199FYB)


Cat: CBMOAB-11199FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11199FYB Monoclonal Zebrafish (Danio rerio), Horse (Equus caballus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO11199FYB 100 µg
CBMOAB-61542FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61542FYA 100 µg
MO-AB-18092Y Monoclonal Sheep (Ovis aries) WB, ELISA MO18092Y 100 µg
MO-AB-46945W Monoclonal Horse (Equus caballus) WB, ELISA MO46945W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Horse (Equus caballus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO11199FYB
SpecificityThis antibody binds to Zebrafish ttpa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a soluble protein that binds alpha-trocopherol, a form of vitamin E, with high selectivity and affinity. This protein plays an important role in regulating vitamin E levels in the body by transporting vitamin E between membrane vesicles and facilitating the secretion of vitamin E from hepatocytes to circulating lipoproteins. Mutations in this gene cause hereditary vitamin E deficiency (ataxia with vitamin E deficiency, AVED) and retinitis pigmentosa. (From NCBI)
Product OverviewMouse Anti-Zebrafish ttpa Antibody is a mouse antibody against ttpa. It can be used for ttpa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesttpa; TTPA Gene(Protein Coding) Alpha Tocopherol Transfer Protein
UniProt IDB0S5J5
Protein RefseqThe length of the protein is 285 amino acids long.
The sequence is show below: MKSEEVDETEELNNLPVDSSRIAPYLSELKEKAEAELRIRDLDLSKTFLIRFLQARDFDVALALKLLINYHKWRQECPEITADLRPSSVIGLLQNNYHGVLRSRDDAGSRVLIYRIGKWNPKEFTAYEVFRVSLITSELIVQEWETQRNGLKAIFDLQDWCFAHALQINPSLAKKISSVLTDSFPLKVRGIHLINEPIFFRPVFAMIRPFLPDKIKQRIHMHGCSYARSLCNYFPKAVLPPVYGGTGPSVDEVCQEWTEYIMQSEDYLHRLSVDLGGEGGHASQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry