Mouse Anti-tyw5 Antibody (CBMOAB-11390FYB)


Cat: CBMOAB-11390FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11390FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO11390FYB 100 µg
CBMOAB-61631FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO61631FYA 100 µg
MO-AB-12219W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12219W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO11390FYB
SpecificityThis antibody binds to Zebrafish tyw5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductiontRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish tyw5 Antibody is a mouse antibody against tyw5. It can be used for tyw5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamestRNA wybutosine-synthesizing protein 5; EC 1.14.11.42; tRNA(Phe; 7-(3-amino-3-carboxypropyl)wyosine(37)-C(2))-hydroxylase; tyw
UniProt IDQ08BV2
Protein RefseqThe length of the protein is 326 amino acids long.
The sequence is show below: MDCQEKLEVPVYTDVDKETFLRDIYPQRRPAVLKRVPIGPCVRTWTVCFLAEKGGDREVKVHVSPEPRMDFLHKNFVYRTLPFDEFIKRAAEAKHPEFFISEDESYYLRSLGEDARKEPADLRKQFPELAEDFHVPQFFEPEQFFSSVFRISSPGLQLWTHYDVMDNLLAQVTGKKRVVLYSPEDALHLYLTGDKSEVLDIDSPDLQLYPEFVKARRYECILEPGDLLFIPALWFHNTLALQFGVGVNVFWRHLPSESYDKKDPYGNKDPVAATRALQSLERTLGILDELPPDYRDFYARRMVLRIQSRAYIRKPINAAQENSDTT.
For Research Use Only | Not For Clinical Use.
Online Inquiry