Mouse Anti-ubiad1 Antibody (CBMOAB-11546FYB)


Cat: CBMOAB-11546FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-11546FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO11546FYB 100 µg
MO-AB-11100W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11100W 100 µg
MO-AB-67316W Monoclonal Marmoset WB, ELISA MO67316W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO11546FYB
SpecificityThis antibody binds to Zebrafish ubiad1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Golgi apparatus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein thought to be involved in cholesterol and phospholipid metabolism. Mutations in this gene are associated with Schnyder crystalline corneal dystrophy. (From NCBI)
Product OverviewMouse Anti-Zebrafish ubiad1 Antibody is a mouse antibody against ubiad1. It can be used for ubiad1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiA prenyltransferase domain-containing protein 1; EC 2.5.1.-; Protein barolo; Protein reddish; ubiad1; bar re
UniProt IDE7FB98
Protein RefseqThe length of the protein is 336 amino acids long.
The sequence is show below: MQEMKPAALSGSNGLNGASGSSVRVPCSRLSRAGRMALDLQSKCAAYVLALRPWSFSASLTPVALGSALAYKLEGSVDLLLLLVCAVAVLLVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDQILKPQDVVMFGAVLYSAGCLCATLLYFLSSLKLEHLALIYFGGLSSSFLYTGGIGLKYVALGDVVILITFGPLAVMFAHAVQVGYLSVLPLVYAVPLALNTEAILHSNNTRDMDSDKQAGIVTLAILLGPTLSYVIYNLLLFVPYLLFCILATRYTISMALPLLTLPMAFPLERQFRCRCYAKIPQKTAKLNLLMGLFYVFGIILAPQGSLPLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry