Mouse Anti-uts2b Antibody (CBMOAB-15612FYB)


Cat: CBMOAB-15612FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15612FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO15612FYB 100 µg
CBMOAB-62030FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62030FYA 100 µg
MO-AB-08996H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08996C 100 µg
MO-AB-20878W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20878W 100 µg
MO-AB-29944H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29944C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO15612FYB
SpecificityThis antibody binds to Zebrafish uts2b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPotent vasoconstrictor.
Product OverviewMouse Anti-Zebrafish uts2b Antibody is a mouse antibody against uts2b. It can be used for uts2b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPrepro-urotensin II-beta; [Cleaved into: Urophysin beta; Urotensin II-beta (U-II-beta) (UII-beta)]; uts2
UniProt IDQ7ZZY8
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MMWKLLLLFALLLTVLEPLLGHPVVQSAEMSFGRPVVVEEEQALNPEELSFSEQAYLSHDAAGFGYPSLISGDISSDGLRTAGFVPSQAVKEALLEKPLWSRFLGSRKQYHKRGSNTECFWKYCV.
For Research Use Only | Not For Clinical Use.
Online Inquiry