AibGenesis™ Mouse Anti-uxt Antibody (CBMOAB-15622FYB)


Cat: CBMOAB-15622FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15622FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Rat (Rattus norvegicus) WB, ELISA MO15622FYB 100 µg
MO-AB-22730R Monoclonal Cattle (Bos taurus) WB, ELISA MO22730R 100 µg
MO-AB-25992W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25992W 100 µg
MO-AB-29945H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29945C 100 µg
MO-AB-38394W Monoclonal Goat (Capra hircus) WB, ELISA MO38394W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Rat (Rattus norvegicus)
CloneMO15622FYB
SpecificityThis antibody binds to Zebrafish uxt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish uxt Antibody is a mouse antibody against uxt. It can be used for uxt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:101894; uxt; zgc:10189
UniProt IDQ66IA7
Protein RefseqThe length of the protein is 155 amino acids long.
The sequence is show below: MTSGTSVINDKVLQYETFISEVLRRDLQKVLEQRDAVYEKIAQYLQLKNTIQSIQESGSKELKTDVDLGCNFYVQAHVPDASRIYVAVGYGFFVEFTHAEALKFIEKKTNQLTEYTEVLTKDAAKIKANIRMVLEGLRELQGLKDLPEDRRREVF.
For Research Use Only | Not For Clinical Use.
Online Inquiry