Mouse Anti-vgll4l Antibody (CBMOAB-15788FYB)


Cat: CBMOAB-15788FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15788FYB Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis) WB, ELISA MO15788FYB 100 µg
MO-AB-09045H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09045C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis)
CloneMO15788FYB
SpecificityThis antibody binds to Zebrafish vgll4l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish vgll4l Antibody is a mouse antibody against vgll4l. It can be used for vgll4l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVestigial like 4 like; vgll4
UniProt IDQ1RLU0
Protein RefseqThe length of the protein is 266 amino acids long.
The sequence is show below: MAVTNFHYITRMSSGFKVYILEGQPNLRSEDRFRHMTSDRVRMRPAHPMKRKHSSDRGRTLEERRERALSKCVANSARRSSGFSIPESPTSTWSPTASPTHLIPSPVFSSPVMDEPLALIKKPRPEPEKTESQNKATTQIQMRPSVITCVSSASRSTKQDCCNHSTAVSKHSYDHVEEHFQRSLGINYHRATSISVSVDDHFAKALGDKWLQLKASSSSCHSSSSSSSSSPPSSPTFIHSPGYSPKRARKDSSSPTTTTPNFWSDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry