Mouse Anti-vhl Antibody (CBMOAB-15790FYB)


Cat: CBMOAB-15790FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15790FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus) WB, ELISA MO15790FYB 100 µg
CBMOAB-34184FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO34184FYA 100 µg
MO-AB-21808W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21808W 100 µg
MO-AB-29977H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29977C 100 µg
MO-AB-34015W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO34015W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus)
CloneMO15790FYB
SpecificityThis antibody binds to Zebrafish vhl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish vhl Antibody is a mouse antibody against vhl. It can be used for vhl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesvhl; Von Hippel-Lindau Tumor Suppressor
UniProt IDF1QY17
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: MPQDSQEGQQPLPLVRSLISRIQVNVLFCNCSPRVVKPVWINFLGEPQPYVNIQPYTGRRITTFVGHPWMFRDAETDDPMVVNNKEMYLPASLENGQVANAKITLPVLTLRDRCLQVVRRLVRREDVGCLEIARCLQEDLAQRPSIQADLQRISQRVEQKLLENRELQNRRKHQH.
For Research Use Only | Not For Clinical Use.
Online Inquiry