Mouse Anti-vmp1 Antibody (CBMOAB-15840FYB)


Cat: CBMOAB-15840FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15840FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO15840FYB 100 µg
MO-AB-11750W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11750W 100 µg
MO-AB-22796R Monoclonal Cattle (Bos taurus) WB, ELISA MO22796R 100 µg
MO-AB-67677W Monoclonal Marmoset WB, ELISA MO67677W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO15840FYB
SpecificityThis antibody binds to Zebrafish vmp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a transmembrane protein that plays a key regulatory role in the process of autophagy. The ectopic overexpression of the encoded protein in cultured cells triggers autophagy even under nutrient-rich conditions. This gene is overexpressed in pancreatitis affected acinar cells where the encoded protein mediates sequestration and degradation of potentially deleterious activated zymogen granules in a process termed, zymophagy. (From NCBI)
Product OverviewMouse Anti-Zebrafish vmp1 Antibody is a mouse antibody against vmp1. It can be used for vmp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVacuole membrane protein 1; Transmembrane protein 49; vmp1; tmem4
UniProt IDQ6NYY9
Protein RefseqThe length of the protein is 406 amino acids long.
The sequence is show below: MAANGAECEQPQKRLGPKDKQNGSSTDSSLRERKQLDREERLSLVLWKRPFITLQYFFLETAITLKEWTWKLWQRRGVVFLTVVLFSLFSLAYSIEGAHQEYVQHLEKKFLWCAYWVGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECGSVNFPEPPYPAQIVCPEDEALQESISLWTIMSKVRLEACMWGAGTAIGELPPYFMARAARMSGADPDDEDYEEFEEMLEHSQSAQDFASRAKLAVQNMVQKVGFFGILACASIPNPLFDLAGITCGHFLIPFWTFFGATLIGKAIIKMHIQKLFVIITFSKHIVEQMVSLIGVIPGVGASLQKPFREYLEAQRTKLHNPAGDGAAAGESWLSWVFEKVVLVMVCYFILSIINSMAQSYAKRLQQKKYSEEKTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry