Mouse Anti-vps37a Antibody (CBMOAB-15886FYB)


Cat: CBMOAB-15886FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15886FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis) WB, ELISA MO15886FYB 100 µg
MO-AB-09075H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09075C 100 µg
MO-AB-22818R Monoclonal Cattle (Bos taurus) WB, ELISA MO22818R 100 µg
MO-AB-25057W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25057W 100 µg
MO-AB-35975W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35975W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis)
CloneMO15886FYB
SpecificityThis antibody binds to Zebrafish vps37a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the VPS37 family, and encodes a component of the ESCRT-I (endosomal sorting complex required for transport I) protein complex, required for the sorting of ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies. Expression of this gene is downregulated in hepatocellular carcinoma, and mutations in this gene are associated with autosomal recessive spastic paraplegia-53. A related pseudogene has been identified on chromosome 5. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Zebrafish vps37a Antibody is a mouse antibody against vps37a. It can be used for vps37a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative vps37
UniProt IDQ6TH08
Protein RefseqThe length of the protein is 387 amino acids long.
The sequence is show below: MNWIFPLSKGSGSIPPLNSLQKQRQRQIESLKAAHSNIAEIQKDVEYRLPFTVNNSTITVNILLPPQFPQEKPVVSVFPPVGHHLVDGNNGTMVTSPLIANFGMHSDLGKVIQSLLDEFWKSPPALMSDPTFPYMYKPSAMPPYPTQSFHFVPAFQPQDGQRPIGPAPVPHAGMEPQQAPPRPAAPAYGLITDLPLPVPTADSQSGLNGHIYKMPDIPDTFSELSEMSVSQLKDMSDQDDVLLDFFMCLPQLKQVTSDKEELVNSIVEMAKKNLQLEPQLEGKRQEMLCKYEQLTQMKSVFETKMQRQHELSESCSLSALQARLKVAAHQAEEESEETAENFLEGKTEIDDFLASFMEKRTLCHSRRAKEEKLQQCMNTHGQFPATL.
For Research Use Only | Not For Clinical Use.
Online Inquiry