Mouse Anti-wdr83 Antibody (CBMOAB-16213FYB)


Cat: CBMOAB-16213FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16213FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO16213FYB 100 µg
MO-AB-22953R Monoclonal Cattle (Bos taurus) WB, ELISA MO22953R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO16213FYB
SpecificityThis antibody binds to Zebrafish wdr83.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish wdr83 Antibody is a mouse antibody against wdr83. It can be used for wdr83 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesWD repeat domain-containing protein 83; Mitogen-activated protein kinase organizer 1; MAPK organizer 1; wdr83; morg
UniProt IDQ6DH44
Protein RefseqThe length of the protein is 315 amino acids long.
The sequence is show below: MAFPQPRPQAPQLPQHLWRTVDCQQGAVRAVRFNADGNYLLTCGSDKSLKLWSVSRGTLLKTYSGHGYEVLDADGSYDNSQLCSCSSDKTVILWDVASGQVTRKLRGHAGKVNCVQFNEEATVMLSGSIDGTVRCWDTRSRRMEPIQILDESQDGISSLKVSEHELLTGSVDGRVRRYDLRMGQLQVDYIGSPITCVCFSRDGQCTLSSSLDSTVRLLDKSTGEMLGEYSGHVNKGYKLDCCLTDKDTHVLSCSEDGHVYYWDLVEGSLTLKLPVGKAVVQSLSFHPTEPRLLTSMEGRVQVWGAEPEDAAENES.
For Research Use Only | Not For Clinical Use.
Online Inquiry