Mouse Anti-wfdc1 Antibody (CBMOAB-16232FYB)
Cat: CBMOAB-16232FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-16232FYB | Monoclonal | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO16232FYB | 100 µg | ||
| CBMOAB-62353FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO62353FYA | 100 µg | ||
| MO-AB-06943W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06943W | 100 µg | ||
| MO-AB-21661W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21661W | 100 µg | ||
| MO-AB-30024H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO30024C | 100 µg | ||
| MO-AB-67880W | Monoclonal | Marmoset | WB, ELISA | MO67880W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO16232FYB |
| Specificity | This antibody binds to Zebrafish wfdc1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. This gene is downregulated in many cancer types and may be involved in the inhibition of cell proliferation. The encoded protein may also play a role in the susceptibility of certain CD4 memory T cells to human immunodeficiency virus infection. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish wfdc1 Antibody is a mouse antibody against wfdc1. It can be used for wfdc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | wfdc1; WAP Four-Disulfide Core Domain 1 |
| UniProt ID | A5WVP3 |
| Protein Refseq | The length of the protein is 220 amino acids long. The sequence is show below: MSGIMQGCQMWTGFVPVLLISFFLLLESGSGNSRMIRKRGLNQKDYEYPNHPQTPQHQKNDRCPPPPQMLPERACEVPGCRSDSECERHKRCCYNGCIYACLESVQPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGDEPLLCPTGYECHIINPGNPSAGIPNRGQCIKQRGNSDGRSLRHKSFKDYKDYTGSNSNNAVNYEKHQHKHLG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry