Mouse Anti-wibg Antibody (CBMOAB-16254FYB)


Cat: CBMOAB-16254FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16254FYB Monoclonal Zebrafish (Danio rerio), Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori) WB, ELISA MO16254FYB 100 µg
CBMOAB-34382FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO34382FYA 100 µg
MO-AB-70542W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70542W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori)
CloneMO16254FYB
SpecificityThis antibody binds to Zebrafish wibg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionKey regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions (By similarity).
Product OverviewMouse Anti-Zebrafish wibg Antibody is a mouse antibody against wibg. It can be used for wibg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPartner of Y14 and mago; Protein wibg homolog; wibg; py
UniProt IDQ6PH11
Protein RefseqThe length of the protein is 194 amino acids long.
The sequence is show below: MATPYVTDESGKYIAATQRPDGSWRKPRRVRDGYVPQEEVPVYENKFVKFFKSKPELPPGVCVETPPQTQTQPSDAAGLSRTAKRNMKRKEKRRQQGQETKSEPELQPEPELQPEPEPQGLSQQMQQLELSASQGPGAADSARRLKNLRKKLRQVEELQQRVLSGELKPSQEQLDKLGRAQALREELQQLEAHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry