Mouse Anti-xylb Antibody (CBMOAB-16523FYB)


Cat: CBMOAB-16523FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16523FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO16523FYB 100 µg
CBMOAB-2995YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO2995YC 100 µg
CBMOAB-62520FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62520FYA 100 µg
MO-AB-09398H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09398C 100 µg
MO-AB-11683W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11683W 100 µg
MO-AB-23040R Monoclonal Cattle (Bos taurus) WB, ELISA MO23040R 100 µg
MO-AB-68000W Monoclonal Marmoset WB, ELISA MO68000W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), E. coli (Escherichia coli ), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO16523FYB
SpecificityThis antibody binds to Zebrafish xylb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene shares 22% sequence identity with Hemophilus influenzae xylulokinase, and even higher identity to other gene products in C.elegans (45%) and yeast (31-35%), which are thought to belong to a family of enzymes that include fucokinase, gluconokinase, glycerokinase and xylulokinase. These proteins play important roles in energy metabolism.
Product OverviewMouse Anti-Zebrafish xylb Antibody is a mouse antibody against xylb. It can be used for xylb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:64119; xylb; zgc:6411
UniProt IDQ7T342
Protein RefseqThe length of the protein is 528 amino acids long.
The sequence is show below: MAEAAESCFLGFDFSTQQLKVVAIDGNLEVIHQSSVQFDSELPEFRTHGGVHIHEDKLTVTSPVLMWVKALDVLLERMRDSGFDFSRVKAVSGSGQQHGSVFWRSGARQTLKRLNPQQRLHHLLQGCFALQDSPVWMDSSTADECVSLEASVGGAQSLADITGSRAYERFTGNQIAKIYRLKPKEFSETERISLISSFAASLFLGDFAPIDFSDGSGMNLMDIFQKRWSSVCLQATAPHLSERLGELTPSTAVLGCVSPYYSERYGFPQNCRVVAFTGDNPGSLAGMRLREGDLAVSLGTSDTVFLWIQEPKPSVEGHIFCNPVDCSAYMALICFKNGSLTRERVRDECAGGSWERFSSALRDTHMGNSGNIGMYYDVLEITPAAAGVHRFNAEGHQVSAFQPQVEIRALVEGQFMAKRVHAEKLGYKIIQGSRVLATGGASANREILQVLSDVFNAPVYTIDVANSACLGCAYRAAHGVVADSGVSFRETVRNAPEPQLAVRPTPGAQEVYLPMLERFAKLEEQLLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry