Mouse Anti-zfand2a Antibody (CBMOAB-16841FYB)


Cat: CBMOAB-16841FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16841FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO16841FYB 100 µg
MO-AB-09476H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09476C 100 µg
MO-AB-15964W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15964W 100 µg
MO-AB-23174R Monoclonal Cattle (Bos taurus) WB, ELISA MO23174R 100 µg
MO-AB-30094H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30094C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO16841FYB
SpecificityThis antibody binds to Zebrafish zfand2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionZFAND3 (Zinc Finger AN1-Type Containing 3) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish zfand2a Antibody is a mouse antibody against zfand2a. It can be used for zfand2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger, AN1-type domain 2A; zfand2a; NP_956811.
UniProt IDQ7SXI4
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: MEFPDLGEHCSEKSCKRLDFLPMKCDACEEIFCKDHITYANHKCTSSYKKDVQVPVCPLCNIPIPIRRGEMPDIKVGEHIDRDCKSDPAQRKRKIFTNKCSKGGCKQKEMIRVTCDQCHLNYCLKHRHPLDHDCKTDNKPVSKSGHAALMRAQGSSSSNTAASSTRGSSRNMSNGVTGNARPQSSSAPRTNTAPPPMVSPTAQNVIPPSVSYQAGLTEEQALQRALEISLAESARASQPTLSPQEQEDLALAQALAASEEEYRRQQQRQQGGVSKQSSCRLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry