Mouse Anti-znf346 Antibody (CBMOAB-18050FYB)


Cat: CBMOAB-18050FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18050FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO18050FYB 100 µg
CBMOAB-63170FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO63170FYA 100 µg
MO-AB-17059W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17059W 100 µg
MO-AB-23283R Monoclonal Cattle (Bos taurus) WB, ELISA MO23283R 100 µg
MO-AB-68455W Monoclonal Marmoset WB, ELISA MO68455W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO18050FYB
SpecificityThis antibody binds to Zebrafish znf346.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA binding, but are also required for its nucleolar localization. The encoded protein may be involved in cell growth and survival. It plays a role in protecting neurons by inhibiting cell cycle re-entry via stimulation of p21 gene expression. Alternative splicing of this gene results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish znf346 Antibody is a mouse antibody against znf346. It can be used for znf346 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger protein 346; znf34
UniProt IDF1Q771
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: MERLVQRMYCLGMRDPPPANIMAQQEPNGDFPYLPSGAAEVNRMIKENSDLFSDSQCKVCSAVLISESQKLAHYQSKKHASKVRRYMSIHGSEEPIAKRFKPSGDDQSNVDEKDKYKACSVCNMTFSSPVVAQSHYQGKVHSKNLRMQSIGSQTPALPQPKAQAKKDDGMQGPAEQDPNRFCSICQASFNNPLMAQQHYSGKKHKKHMNKQKLMETFGPSTAPASTVKGYPCTVCNIELNSVEQYQAHISGSKHKNHAKPKKGPNAFAPPPDNYQPDYQYPTNEDCLEDPAEWDSFNVAYE.
For Research Use Only | Not For Clinical Use.
Online Inquiry