Mouse Anti-znf407 Antibody (CBMOAB-18088FYB)


Cat: CBMOAB-18088FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18088FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO18088FYB 100 µg
CBMOAB-63214FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO63214FYA 100 µg
MO-AB-07153W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07153W 100 µg
MO-AB-20491W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20491W 100 µg
MO-AB-68476W Monoclonal Marmoset WB, ELISA MO68476W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO18088FYB
SpecificityThis antibody binds to Zebrafish znf407.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a zinc finger protein whose exact function is not known. It may be involved in transcriptional regulation. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish znf407 Antibody is a mouse antibody against znf407. It can be used for znf407 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesznf407; LOC101884678 si:ch73-173g15.1; Zinc Finger Protein 407
UniProt IDF8W3Y7
Protein RefseqThe length of the protein is 635 amino acids long.
The sequence is show below: PKTLDAKNAKSIPRIRCEDCGFLADGISGLNVHISMKHPSKEKNFHCLLCGKSFYTDSNLQQHLGSAAHMRNENGSIEELAEGGASFKCVRCNEPCQTEQELFVHIKEKHEELLREVNKYVLEDTEQINRERQENQGSVCKYCGKVCKSSNSMAFLAHVRTHTGSKPFRCKICNFSTAQLGDARNHVKRHLGMREYKCHICGWAFVMKKHLNTHLLGKHGLGQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry