AibGenesis™ Mouse Anti-znf593 Antibody (CBMOAB-18140FYB)


Cat: CBMOAB-18140FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18140FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO18140FYB 100 µg
MO-AB-09537H Monoclonal Frog (Xenopus laevis) WB, ELISA MO09537C 100 µg
MO-AB-18283W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18283W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO18140FYB
SpecificityThis antibody binds to Zebrafish znf593.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish znf593 Antibody is a mouse antibody against znf593. It can be used for znf593 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesznf593; Zinc Finger Protein 593
UniProt IDE7FCM9
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MGKSKQVGNHNNGKKKNIAKTWKTKRRTKDLDQIHADMIPTNAAKLLKQDVDYDVTGCGQHYCLHCARYFVDLKTLKEHFKSKPHKKRLKQLREEPYTQAEAERAAGMGSYIPPKTLEVHTQQVEEDMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry