AibGenesis™ Mouse Anti-trbD Antibody (CBMOAB-2808YC)
Cat: CBMOAB-2808YC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | E. coli (Escherichia coli ), Fruit fly (Drosophila melanogaster) |
| Clone | MO2808YC |
| Specificity | This antibody binds to Escherichia coli K-12 trbD. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Positive regulator of the Wnt signaling pathway. Specifically cleaves ''Lys-63''-linked ubiquitin chains. May act by deubiquitinating APC protein, a negative regulator of Wnt-mediated transcription. Required for an efficient wg response, but not for other signaling responses, in the eye. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-E. coli trbD Antibody is a mouse antibody against trbD. It can be used for trbD detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein TrbD; trbD; ECOK12F080 |
| UniProt ID | P41070 |
| Protein Refseq | The length of the protein is 65 amino acids long. The sequence is show below: MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAVGVMKNSEI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry