AibGenesis™ Mouse Anti-selenof Antibody (CBMOAB-97620FYA)


Cat: CBMOAB-97620FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97620FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO97620FYA 100 µg
MO-AB-07500H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07500C 100 µg
MO-AB-19902R Monoclonal Cattle (Bos taurus) WB, ELISA MO19902R 100 µg
MO-AB-28907H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28907C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO97620FYA
SpecificityThis antibody binds to Zebrafish 44089.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish 44089 Antibody is a mouse antibody against 44089. It can be used for 44089 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names15 kDa selenoprotein; sep15; cb2
UniProt IDQ802F3
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MAGEVYLLWLLPLLQGLASYGAELSSEACRELGFSSNLLCSSCELLGQFSLNQLDLPCRQCCQEEAQLENRKLYPGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI.
For Research Use Only | Not For Clinical Use.
Online Inquiry